Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [193543] (2 PDB entries) |
Domain d3zxwd_: 3zxw D: [193544] Other proteins in same PDB: d3zxwa1, d3zxwa2, d3zxwc1, d3zxwc2, d3zxwe1, d3zxwe2, d3zxwg1, d3zxwg2 automated match to d1rsci_ complexed with cap, gol, mg |
PDB Entry: 3zxw (more details), 2.1 Å
SCOPe Domain Sequences for d3zxwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxwd_ d.73.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} sylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfnctnaqdvlnev qqcrseypncfirvvafdnikqcqvmsfivykp
Timeline for d3zxwd_: