Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab CHI621 (mouse), kappa L chain [48824] (1 PDB entry) |
Domain d1mimh1: 1mim H:1-115 [20129] Other proteins in same PDB: d1mimh2, d1miml2 |
PDB Entry: 1mim (more details), 2.6 Å
SCOP Domain Sequences for d1mimh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mimh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab CHI621 (mouse), kappa L chain} qlqqsgtvlarpgasvkmsckasgysftrywmhwikqrpgqglewigaiypgnsdtsynq kfegkakltavtsastaymelsslthedsavyycsrdygyyfdfwgqgttltvss
Timeline for d1mimh1: