SCOP 1.57: Domain d1miml1: 1mim L:1-105

Lineage for d1miml1 (1mim L:1-105)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab CHI621 (mouse), kappa L chain [48824] (1 PDB entry)

8. Domain d1miml1: 1mim L:1-105 [20128]
   Other proteins in same PDB: d1mimh2, d1miml2

Details for d1miml1

PDB Entry: 1mim, 2.6 Å

PDB Description: igg fab fragment (cd25-binding)

SCOP Domain Sequences for d1miml1:

Sequence; same for both SEQRES and ATOM records:

>d1miml1 b.1.1.1 (L:1-105) Immunoglobulin (variable domains of L and H chains) {Fab CHI621 (mouse), kappa L chain}
qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikr

Timeline for d1miml1:

• d1miml1 first appeared (with stable ids) in SCOP 1.55
  
• d1miml1 appears in SCOP 1.59
  
• d1miml1 appears in the current release, SCOPe 2.08