Lineage for d1ad0a1 (1ad0 A:1-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930397Species Engineered (including hybrid species) [88533] (52 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 930431Domain d1ad0a1: 1ad0 A:1-107 [20124]
    Other proteins in same PDB: d1ad0a2, d1ad0b1, d1ad0b2, d1ad0c2, d1ad0d1, d1ad0d2
    part of humanized Fab A5B7

Details for d1ad0a1

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7
PDB Compounds: (A:) antibody a5b7 (light chain)

SCOPe Domain Sequences for d1ad0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkr

SCOPe Domain Coordinates for d1ad0a1:

Click to download the PDB-style file with coordinates for d1ad0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ad0a1: