Lineage for d1fj1c1 (1fj1 C:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102788Species Fab LA-2 (mouse), kappa L chain [48821] (1 PDB entry)
  8. 102791Domain d1fj1c1: 1fj1 C:1-107 [20120]
    Other proteins in same PDB: d1fj1a2, d1fj1b2, d1fj1c2, d1fj1d2, d1fj1e_, d1fj1f_

Details for d1fj1c1

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1c1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab LA-2 (mouse), kappa L chain}
diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik

SCOP Domain Coordinates for d1fj1c1:

Click to download the PDB-style file with coordinates for d1fj1c1.
(The format of our PDB-style files is described here.)

Timeline for d1fj1c1: