Lineage for d3u87b_ (3u87 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931173Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1931174Species Human (Homo sapiens) [TaxId:9606] [75559] (45 PDB entries)
  8. 1931213Domain d3u87b_: 3u87 B: [200943]
    automated match to d3u87a_
    complexed with anp, cl, gol, mg, so4

Details for d3u87b_

PDB Entry: 3u87 (more details), 2.9 Å

PDB Description: structure of a chimeric construct of human ck2alpha and human ck2alpha' in complex with a non-hydrolysable atp-analogue
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3u87b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u87b_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfypvvke

SCOPe Domain Coordinates for d3u87b_:

Click to download the PDB-style file with coordinates for d3u87b_.
(The format of our PDB-style files is described here.)

Timeline for d3u87b_: