Lineage for d3tmqa_ (3tmq A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342981Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1343178Protein automated matches [190083] (7 species)
    not a true protein
  7. 1343182Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries)
  8. 1343191Domain d3tmqa_: 3tmq A: [200846]
    automated match to d3unda_
    complexed with a5p, edo, no3

Details for d3tmqa_

PDB Entry: 3tmq (more details), 2.1 Å

PDB Description: Crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei in complex with D-arabinose-5-phosphate
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase 2

SCOPe Domain Sequences for d3tmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tmqa_ c.1.10.4 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfdkan
rssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpaflarqt
dlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvvdml
gfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfleahp
dpdrarcdgpsalplhqlegllsqmkaiddlvkrmpalei

SCOPe Domain Coordinates for d3tmqa_:

Click to download the PDB-style file with coordinates for d3tmqa_.
(The format of our PDB-style files is described here.)

Timeline for d3tmqa_: