Lineage for d3t6eh2 (3t6e H:37-258)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1542883Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1542884Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1542885Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1542886Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1542979Species Rhodopseudomonas viridis [TaxId:1079] [50349] (15 PDB entries)
  8. 1542981Domain d3t6eh2: 3t6e H:37-258 [200767]
    Other proteins in same PDB: d3t6ec_, d3t6eh1, d3t6el_, d3t6em_
    automated match to d6prch1
    complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6eh2

PDB Entry: 3t6e (more details), 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3t6eh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6eh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d3t6eh2:

Click to download the PDB-style file with coordinates for d3t6eh2.
(The format of our PDB-style files is described here.)

Timeline for d3t6eh2: