SCOPe 2.08: Domain d3t6eh2: 3t6e H:37-258

Lineage for d3t6eh2 (3t6e H:37-258)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [50349] (26 PDB entries)

8. Domain d3t6eh2: 3t6e H:37-258 [200767]
   Other proteins in same PDB: d3t6ec_, d3t6eh1, d3t6el_, d3t6em_
   automated match to d6prch1
   complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6eh2

PDB Entry: 3t6e, 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3t6eh2:

Sequence; same for both SEQRES and ATOM records:

>d3t6eh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Timeline for d3t6eh2:

• d3t6eh2 first appeared in SCOPe 2.03
  
• d3t6eh2 appears in SCOPe 2.07