SCOPe 2.05: Domain d3qjvb1: 3qjv B:3-40

Lineage for d3qjvb1 (3qjv B:3-40)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d3qjvb1: 3qjv B:3-40 [200358]
   Other proteins in same PDB: d3qjva_, d3qjvb2, d3qjvc_
   automated match to d1ehkb2
   complexed with cmo, cu1, cua, has, hem

Details for d3qjvb1

PDB Entry: 3qjv, 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3qjvb1:

Sequence; same for both SEQRES and ATOM records:

>d3qjvb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

Timeline for d3qjvb1:

• d3qjvb1 first appeared in SCOPe 2.03
  
• d3qjvb1 appears in SCOPe 2.04
  
• d3qjvb1 appears in SCOPe 2.06
  
• d3qjvb1 appears in the current release, SCOPe 2.08