Lineage for d3qipa2 (3qip A:430-556)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606644Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 1606645Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)
  8. 1606648Domain d3qipa2: 3qip A:430-556 [200353]
    Other proteins in same PDB: d3qipa1, d3qipb_
    automated match to d1c1ba1
    complexed with cl, mn, nvp, p4y, so4

Details for d3qipa2

PDB Entry: 3qip (more details), 2.09 Å

PDB Description: Structure of HIV-1 reverse transcriptase in complex with an RNase H inhibitor and nevirapine
PDB Compounds: (A:) Reverse HIV-1 reverse transcriptase p66

SCOPe Domain Sequences for d3qipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qipa2 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOPe Domain Coordinates for d3qipa2:

Click to download the PDB-style file with coordinates for d3qipa2.
(The format of our PDB-style files is described here.)

Timeline for d3qipa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qipa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3qipb_