SCOPe 2.08: Domain d3qipa2: 3qip A:430-556

Lineage for d3qipa2 (3qip A:430-556)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)

8. Domain d3qipa2: 3qip A:430-556 [200353]
   Other proteins in same PDB: d3qipa1, d3qipb_
   automated match to d1c1ba1
   complexed with cl, mn, nvp, p4y, so4

Details for d3qipa2

PDB Entry: 3qip, 2.09 Å

PDB Description: Structure of HIV-1 reverse transcriptase in complex with an RNase H inhibitor and nevirapine

PDB Compounds: (A:) Reverse HIV-1 reverse transcriptase p66

SCOPe Domain Sequences for d3qipa2:

Sequence; same for both SEQRES and ATOM records:

>d3qipa2 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d3qipa2:

• d3qipa2 first appeared in SCOPe 2.03
  
• d3qipa2 appears in SCOPe 2.07