SCOPe 2.04: Domain d3qdmd1: 3qdm D:2-109

Lineage for d3qdmd1 (3qdm D:2-109)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3qdmd1: 3qdm D:2-109 [200317]
   Other proteins in same PDB: d3qdma1, d3qdma2, d3qdmb_, d3qdmd2, d3qdme2
   automated match to d1qrnd1

Details for d3qdmd1

PDB Entry: 3qdm, 2.8 Å

PDB Description: The complex between TCR DMF4 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) decameric peptide

PDB Compounds: (D:) DMF4 alpha chain

SCOPe Domain Sequences for d3qdmd1:

Sequence; same for both SEQRES and ATOM records:

>d3qdmd1 b.1.1.0 (D:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqspqsmfiqegedvsmnctsssifntwlwykqdpgegpvllialykageltsngrlt
aqfgitrkdsflnisasipsdvgiyfcaggtgnqfyfgtgtsltvipn

Timeline for d3qdmd1:

• d3qdmd1 first appeared in SCOPe 2.03
  
• d3qdmd1 appears in SCOPe 2.05
  
• d3qdmd1 appears in the current release, SCOPe 2.08