SCOPe 2.05: Domain d3qdga2: 3qdg A:182-275

Lineage for d3qdga2 (3qdg A:182-275)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (189 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d3qdga2: 3qdg A:182-275 [200304]
   Other proteins in same PDB: d3qdga1, d3qdgb_, d3qdgd1, d3qdgd2, d3qdge1, d3qdge2
   automated match to d1i4fa1

Details for d3qdga2

PDB Entry: 3qdg, 2.69 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3qdga2:

Sequence; same for both SEQRES and ATOM records:

>d3qdga2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d3qdga2:

• d3qdga2 first appeared in SCOPe 2.03
  
• d3qdga2 appears in SCOPe 2.04
  
• d3qdga2 appears in SCOPe 2.06
  
• d3qdga2 appears in the current release, SCOPe 2.08