Lineage for d3q3gj1 (3q3g J:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370418Domain d3q3gj1: 3q3g J:1-113 [200284]
    Other proteins in same PDB: d3q3ga2, d3q3gc2, d3q3ge_, d3q3gf2, d3q3gg_, d3q3gi_, d3q3gj2, d3q3gl_
    automated match to d1dqdl1
    complexed with ca, cl, edo, gol, na, peg

Details for d3q3gj1

PDB Entry: 3q3g (more details), 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (J:) Antibody Light Chain

SCOPe Domain Sequences for d3q3gj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3gj1 b.1.1.0 (J:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelk

SCOPe Domain Coordinates for d3q3gj1:

Click to download the PDB-style file with coordinates for d3q3gj1.
(The format of our PDB-style files is described here.)

Timeline for d3q3gj1: