SCOPe 2.08: Domain d3q3gj1: 3q3g J:1-113

Lineage for d3q3gj1 (3q3g J:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3q3gj1: 3q3g J:1-113 [200284]
   Other proteins in same PDB: d3q3ga2, d3q3gb1, d3q3gb2, d3q3gc2, d3q3gd1, d3q3gd2, d3q3ge_, d3q3gf2, d3q3gg_, d3q3gh1, d3q3gh2, d3q3gi_, d3q3gj2, d3q3gk1, d3q3gk2, d3q3gl_
   automated match to d1dqdl1
   complexed with ca, cl, edo, gol, na, peg

Details for d3q3gj1

PDB Entry: 3q3g, 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (J:) Antibody Light Chain

SCOPe Domain Sequences for d3q3gj1:

Sequence; same for both SEQRES and ATOM records:

>d3q3gj1 b.1.1.0 (J:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelk

Timeline for d3q3gj1:

• d3q3gj1 first appeared in SCOPe 2.03
  
• d3q3gj1 appears in SCOPe 2.07