Lineage for d3pwpd1 (3pwp D:1-117)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289756Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 1289777Domain d3pwpd1: 3pwp D:1-117 [200269]
    Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb_, d3pwpd2, d3pwpe1, d3pwpe2
    automated match to d1qsed1
    complexed with gol, so4

Details for d3pwpd1

PDB Entry: 3pwp (more details), 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide
PDB Compounds: (D:) A6 TCR alpha chain

SCOPe Domain Sequences for d3pwpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwpd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavttdswgklqfgagtqvvvtpd

SCOPe Domain Coordinates for d3pwpd1:

Click to download the PDB-style file with coordinates for d3pwpd1.
(The format of our PDB-style files is described here.)

Timeline for d3pwpd1: