SCOPe 2.03: Domain d3pwpe2: 3pwp E:118-246

Lineage for d3pwpe2 (3pwp E:118-246)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3pwpe2: 3pwp E:118-246 [200272]
   Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb_, d3pwpd1, d3pwpd2, d3pwpe1
   automated match to d1ktke2
   complexed with gol, so4

Details for d3pwpe2

PDB Entry: 3pwp, 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide

PDB Compounds: (E:) A6 TCR beta chain

SCOPe Domain Sequences for d3pwpe2:

Sequence; same for both SEQRES and ATOM records:

>d3pwpe2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3pwpe2:

• d3pwpe2 is new in SCOPe 2.03-stable
  
• d3pwpe2 appears in SCOPe 2.04
  
• d3pwpe2 appears in the current release, SCOPe 2.08