Lineage for d3puwa2 (3puw A:236-372)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790106Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 1790190Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 1790210Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 1790211Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 1790214Domain d3puwa2: 3puw A:236-372 [200237]
    Other proteins in same PDB: d3puwa1, d3puwb1, d3puwe_, d3puwf1, d3puwf2, d3puwg_
    automated match to d1q12a1
    complexed with adp, alf, mal, mg, pgv, umq

Details for d3puwa2

PDB Entry: 3puw (more details), 2.3 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4
PDB Compounds: (A:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d3puwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puwa2 b.40.6.3 (A:236-372) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgva

SCOPe Domain Coordinates for d3puwa2:

Click to download the PDB-style file with coordinates for d3puwa2.
(The format of our PDB-style files is described here.)

Timeline for d3puwa2: