Lineage for d3pote2 (3pot E:189-443)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275095Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1275096Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1275158Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 1275159Protein automated matches [227075] (2 species)
    not a true protein
  7. 1275160Species Methanothermobacter marburgensis [TaxId:145263] [226796] (1 PDB entry)
  8. 1275164Domain d3pote2: 3pot E:189-443 [200223]
    Other proteins in same PDB: d3pota1, d3potb1, d3potc_, d3potd1, d3pote1, d3potf_
    automated match to d1e6vb1
    complexed with 06c, com, edo, f43, k, mg, tp7, txz

Details for d3pote2

PDB Entry: 3pot (more details), 1.2 Å

PDB Description: structural analysis of a ni(iii)-methyl species in methyl-coenzyme m reductase from methanothermobacter marburgensis
PDB Compounds: (E:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d3pote2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pote2 a.89.1.0 (E:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d3pote2:

Click to download the PDB-style file with coordinates for d3pote2.
(The format of our PDB-style files is described here.)

Timeline for d3pote2: