SCOPe 2.05: Domain d3ox4a_: 3ox4 A:

Lineage for d3ox4a_ (3ox4 A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
   2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array

4. Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families)

5. Family e.22.1.0: automated matches [191565] (1 protein)
   not a true family

6. Protein automated matches [190982] (7 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [196376] (2 PDB entries)

8. Domain d3ox4a_: 3ox4 A: [200182]
   automated match to d3ox4d_
   complexed with fe2, nad

Details for d3ox4a_

PDB Entry: 3ox4, 2 Å

PDB Description: Structures of iron-dependent alcohol dehydrogenase 2 from Zymomonas mobilis ZM4 complexed with NAD cofactor

PDB Compounds: (A:) Alcohol dehydrogenase 2

SCOPe Domain Sequences for d3ox4a_:

Sequence; same for both SEQRES and ATOM records:

>d3ox4a_ e.22.1.0 (A:) automated matches {Zymomonas mobilis [TaxId: 542]}
asstfyipfvnemgegslekaikdlngsgfknalivsdafmnksgvvkqvadllkaqgin
savydgvmpnptvtavleglkilkdnnsdfvislgggsphdcakaialvatnggevkdye
gidkskkpalplmsinttagtasemtrfciitdevrhvkmaivdrhvtpmvsvndpllmv
gmpkgltaatgmdalthafeaysstaatpitdacalkaasmiaknlktacdngkdmpare
amayaqflagmafnnaslgyvhamahqlggyynlphgvcnavllphvlaynasvvagrlk
dvgvamgldianlgdkegaeatiqavrdlaasigipanltelgakkedvplladhalkda
caltnprqgdqkeveelflsaf

Timeline for d3ox4a_:

• d3ox4a_ first appeared in SCOPe 2.03
  
• d3ox4a_ appears in SCOPe 2.04
  
• d3ox4a_ appears in SCOPe 2.06
  
• d3ox4a_ appears in the current release, SCOPe 2.08