Lineage for d3o9ba_ (3o9b A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067690Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (50 PDB entries)
  8. 2067718Domain d3o9ba_: 3o9b A: [200023]
    automated match to d2f3ka_
    complexed with act, gol, k2a, po4

Details for d3o9ba_

PDB Entry: 3o9b (more details), 1.5 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with kd25
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d3o9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3o9ba_:

Click to download the PDB-style file with coordinates for d3o9ba_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ba_: