Lineage for d3n4ma1 (3n4m A:7-137)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1808270Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1808276Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1808277Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 1808278Species Escherichia coli [TaxId:562] [51212] (30 PDB entries)
  8. 1808318Domain d3n4ma1: 3n4m A:7-137 [199931]
    Other proteins in same PDB: d3n4ma2, d3n4mb_, d3n4mc_
    automated match to d1i5zb2
    protein/DNA complex; protein/RNA complex; complexed with cmp, peg

Details for d3n4ma1

PDB Entry: 3n4m (more details), 2.99 Å

PDB Description: e. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d3n4ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n4ma1 b.82.3.2 (A:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl

SCOPe Domain Coordinates for d3n4ma1:

Click to download the PDB-style file with coordinates for d3n4ma1.
(The format of our PDB-style files is described here.)

Timeline for d3n4ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n4ma2