Lineage for d3mjic_ (3mji C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988501Family d.153.1.3: Penicillin V acylase [56248] (2 proteins)
    automatically mapped to Pfam PF02275
  6. 2988516Protein automated matches [190722] (1 species)
    not a true protein
  7. 2988517Species Bacillus sphaericus [TaxId:1421] [188588] (4 PDB entries)
  8. 2988527Domain d3mjic_: 3mji C: [199854]
    automated match to d2iwma_
    mutant

Details for d3mjic_

PDB Entry: 3mji (more details), 2.5 Å

PDB Description: activation of catalytic cysteine without a base in a mutant penicillin acylase precursor
PDB Compounds: (C:) penicillin acylase

SCOPe Domain Sequences for d3mjic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjic_ d.153.1.3 (C:) automated matches {Bacillus sphaericus [TaxId: 1421]}
mlgssslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgm
gstditspvlydgvnekglmgamlyyatfatyadepkkgtrginpvyvisqvlgncvtvd
dviekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnsp
gyewhqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkk
ytekaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydns
risavslmaenlnsqdlitfewdrkqdikqlnq

SCOPe Domain Coordinates for d3mjic_:

Click to download the PDB-style file with coordinates for d3mjic_.
(The format of our PDB-style files is described here.)

Timeline for d3mjic_: