Lineage for d1ncbh1 (1ncb H:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219893Species Fab NC41 (mouse), kappa L chain [48790] (4 PDB entries)
  8. 219894Domain d1ncbh1: 1ncb H:1-113 [19981]
    Other proteins in same PDB: d1ncbh2, d1ncbl2, d1ncbn_
    complexed with ca, man, nag; mutant

Details for d1ncbh1

PDB Entry: 1ncb (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncbh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab NC41 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglewmgwintntgepty
geefkgrfafsletsastanlqinnlknedkatffcargednfgslsdywgqgttltvss

SCOP Domain Coordinates for d1ncbh1:

Click to download the PDB-style file with coordinates for d1ncbh1.
(The format of our PDB-style files is described here.)

Timeline for d1ncbh1: