SCOPe 2.07: Domain d3m1pa_: 3m1p A:

Lineage for d3m1pa_ (3m1p A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.0: automated matches [191649] (1 protein)
   not a true family

6. Protein automated matches [191196] (11 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [193715] (1 PDB entry)

8. Domain d3m1pa_: 3m1p A: [199768]
   automated match to d3m1pb_
   complexed with po4

Details for d3m1pa_

PDB Entry: 3m1p, 2.2 Å

PDB Description: Structure of ribose 5-phosphate isomerase type B from Trypanosoma cruzi, soaked with allose-6-phosphate

PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3m1pa_:

Sequence; same for both SEQRES and ATOM records:

>d3m1pa_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlaagsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
reiiitflqtpfsgeerhvrriekiraieasha

Timeline for d3m1pa_:

• d3m1pa_ first appeared in SCOPe 2.03
  
• d3m1pa_ appears in SCOPe 2.06
  
• d3m1pa_ appears in the current release, SCOPe 2.08