Lineage for d3m1pb_ (3m1p B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529227Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2529228Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2529280Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2529281Protein automated matches [191196] (11 species)
    not a true protein
  7. 2529342Species Trypanosoma cruzi [TaxId:5693] [193715] (1 PDB entry)
  8. 2529344Domain d3m1pb_: 3m1p B: [193716]
    automated match to d3k7pa_
    complexed with po4

Details for d3m1pb_

PDB Entry: 3m1p (more details), 2.2 Å

PDB Description: Structure of ribose 5-phosphate isomerase type B from Trypanosoma cruzi, soaked with allose-6-phosphate
PDB Compounds: (B:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3m1pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1pb_ c.121.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
trrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvarke
vefgvlaagsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevir
eiiitflqtpfsgeerhvrriekiraieasha

SCOPe Domain Coordinates for d3m1pb_:

Click to download the PDB-style file with coordinates for d3m1pb_.
(The format of our PDB-style files is described here.)

Timeline for d3m1pb_: