Lineage for d3ljzc_ (3ljz C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1917932Protein Collagenase-3 (MMP-13) [55540] (2 species)
  7. 1917933Species Human (Homo sapiens) [TaxId:9606] [55541] (40 PDB entries)
  8. 1917972Domain d3ljzc_: 3ljz C: [199734]
    automated match to d3ljzd_
    complexed with ca, epe, la3, so4, zn

Details for d3ljzc_

PDB Entry: 3ljz (more details), 2 Å

PDB Description: crystal structure of human mmp-13 complexed with an amino-2-indanol compound
PDB Compounds: (C:) collagenase 3

SCOPe Domain Sequences for d3ljzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljzc_ d.92.1.11 (C:) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
anvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahe
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslyg

SCOPe Domain Coordinates for d3ljzc_:

Click to download the PDB-style file with coordinates for d3ljzc_.
(The format of our PDB-style files is described here.)

Timeline for d3ljzc_: