Lineage for d3l9re1 (3l9r E:3-183)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1898109Protein automated matches [191280] (3 species)
    not a true protein
  7. 1898110Species Cow (Bos taurus) [TaxId:9913] [225910] (2 PDB entries)
  8. 1898114Domain d3l9re1: 3l9r E:3-183 [199721]
    Other proteins in same PDB: d3l9ra2, d3l9rb_, d3l9rc2, d3l9rd_, d3l9re2, d3l9rf_, d3l9rg2, d3l9rh_
    automated match to d1gzpa2
    complexed with cl, gol, l9q, l9r, nag

Details for d3l9re1

PDB Entry: 3l9r (more details), 2.3 Å

PDB Description: crystal structure of bovine cd1b3 with endogenously bound ligands
PDB Compounds: (E:) CD1b3

SCOPe Domain Sequences for d3l9re1:

Sequence, based on SEQRES records: (download)

>d3l9re1 d.19.1.1 (E:3-183) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vfqgptsfhlmqistfvnstwaqnqgsgwlddlqihgwesdsgtaiflkpwskgnfsdde
vtelvdlfrayfigftrevqdrvnefqleypfviqvtagcelhsgeaiesslrgalggld
fvsiqnhscvpapdsgsrgqkfcalttqyqgisdiierllsetcpryllgvldagkaelq
r

Sequence, based on observed residues (ATOM records): (download)

>d3l9re1 d.19.1.1 (E:3-183) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vfqgptsfhlmqistfvnstwaqnqgsgwlddlqihgwesdsgtaiflkpwskgnfsdde
vtelvdlfrayfigftrevqdrvnefqleypfviqvtagcelhsgaiesslrgalggldf
vsiqnhscvpapdsgsrgqkfcalttqyqgisdiierllsetcpryllgvldagkaelqr

SCOPe Domain Coordinates for d3l9re1:

Click to download the PDB-style file with coordinates for d3l9re1.
(The format of our PDB-style files is described here.)

Timeline for d3l9re1: