SCOPe 2.05: Domain d3ksma_: 3ksm A:

Lineage for d3ksma_ (3ksm A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (60 species)
   not a true protein

7. Species Hahella chejuensis [TaxId:349521] [196493] (1 PDB entry)

8. Domain d3ksma_: 3ksm A: [199679]
   automated match to d3ksmb_
   complexed with bdr

Details for d3ksma_

PDB Entry: 3ksm, 1.9 Å

PDB Description: crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis

PDB Compounds: (A:) ABC-type sugar transport system, periplasmic component

SCOPe Domain Sequences for d3ksma_:

Sequence; same for both SEQRES and ATOM records:

>d3ksma_ c.93.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]}
pklllvlkgdsnaywrqvylgaqkaadeagvtllhrstkddgdiagqiqilsyhlsqapp
dalilapnsaedltpsvaqyrarnipvlvvdsdlagdahqglvatdnyaagqlaaralla
tldlskerniallrlragnastdqreqgfldvlrkhdkiriiaapyagddrgaarsemlr
llketptidglftpnesttigalvairqsgmskqfgfigfdqteeleaamyageisnlvv
qnpeymgylavqraldlvrgkpipaftdtgvrllqe

Timeline for d3ksma_:

• d3ksma_ first appeared in SCOPe 2.03
  
• d3ksma_ appears in SCOPe 2.04
  
• d3ksma_ is called d3ksma1 in SCOPe 2.06
  
• d3ksma_ appears in the current release, SCOPe 2.08, called d3ksma1