Lineage for d3jwqb_ (3jwq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2350089Protein automated matches [190370] (2 species)
    not a true protein
  7. 2350090Species Human (Homo sapiens) [TaxId:9606] [187208] (37 PDB entries)
  8. 2350147Domain d3jwqb_: 3jwq B: [199594]
    Other proteins in same PDB: d3jwqc2
    automated match to d3jwrb_
    complexed with mg, via, zn

Details for d3jwqb_

PDB Entry: 3jwq (more details), 2.87 Å

PDB Description: crystal structure of chimeric pde5/pde6 catalytic domain complexed with sildenafil
PDB Compounds: (B:) cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera

SCOPe Domain Sequences for d3jwqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwqb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
dhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlki
ikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiq
qriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyealthv
sedcfplldgcrknrqkwqalaeq

SCOPe Domain Coordinates for d3jwqb_:

Click to download the PDB-style file with coordinates for d3jwqb_.
(The format of our PDB-style files is described here.)

Timeline for d3jwqb_: