Lineage for d3g64a_ (3g64 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854326Species Streptomyces coelicolor [TaxId:100226] [196597] (1 PDB entry)
  8. 2854327Domain d3g64a_: 3g64 A: [199433]
    automated match to d3g64c_
    complexed with edo, gol, so4, zn

Details for d3g64a_

PDB Entry: 3g64 (more details), 2.05 Å

PDB Description: Crystal structure of putative enoyl-CoA hydratase from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) Putative enoyl-CoA hydratase

SCOPe Domain Sequences for d3g64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g64a_ c.14.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
mspftgsaaptpewrhlrveitdgvatvtlarpdklnaltfeayadlrdllaelsrrrav
ralvlagegrgfcsggdvdeiigatlsmdtarlldfnrmtgqvvravrecpfpviaalhg
vaagagavlalaadfrvadpstrfaflftrvglsggdmgaayllprvvglghatrllmlg
dtvrapeaerigliselteegradeaartlarrladgpalahaqtkalltaeldmplaaa
veldastqallmtgedyaefhaaftekrppkwqgr

SCOPe Domain Coordinates for d3g64a_:

Click to download the PDB-style file with coordinates for d3g64a_.
(The format of our PDB-style files is described here.)

Timeline for d3g64a_: