Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab 1F7 (mouse), kappa L chain [48782] (1 PDB entry) |
Domain d1figh1: 1fig H:1-113 [19923] Other proteins in same PDB: d1figh2, d1figl2 |
PDB Entry: 1fig (more details), 3 Å
SCOP Domain Sequences for d1figh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1figh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab 1F7 (mouse), kappa L chain} dvqlqqsgpelekpgasvkisckasgfslpghninwivqrngkslewignidpyyggtnf npkfkgkatltvdkssstlymhltslqsedsavyycarrrdgnygftywgqgtlvtvsa
Timeline for d1figh1: