SCOPe 2.06: Domain d3cynb1: 3cyn B:44-209

Lineage for d3cynb1 (3cyn B:44-209)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)

8. Domain d3cynb1: 3cyn B:44-209 [199222]
   Other proteins in same PDB: d3cyna2, d3cynb2, d3cync2
   automated match to d3cync_
   complexed with gol, so4

Details for d3cynb1

PDB Entry: 3cyn, 2 Å

PDB Description: the structure of human gpx8

PDB Compounds: (B:) Probable glutathione peroxidase 8

SCOPe Domain Sequences for d3cynb1:

Sequence; same for both SEQRES and ATOM records:

>d3cynb1 c.47.1.0 (B:44-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
insfyafevkdakgrtvslekykgkvslvvnvasdcqltdrnylglkelhkefgpshfsv
lafpcnqfgeseprpskevesfarknygvtfpifhkikilgsegepafrflvdsskkepr
wnfwkylvnpegqvvkfwrpeepievirpdiaalvrqviikkkedl

Timeline for d3cynb1:

• d3cynb1 first appeared in SCOPe 2.03, called d3cynb_
  
• d3cynb1 was called d3cynb_ in SCOPe 2.05
  
• d3cynb1 appears in SCOPe 2.07
  
• d3cynb1 appears in the current release, SCOPe 2.08