SCOP 1.57: Domain d6fabh1: 6fab H:1-121

Lineage for d6fabh1 (6fab H:1-121)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 36-71 (mouse), kappa L chain [48779] (1 PDB entry)

8. Domain d6fabh1: 6fab H:1-121 [19909]
   Other proteins in same PDB: d6fabh2, d6fabl2

Details for d6fabh1

PDB Entry: 6fab, 1.9 Å

PDB Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten

SCOP Domain Sequences for d6fabh1:

Sequence; same for both SEQRES and ATOM records:

>d6fabh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 36-71 (mouse), kappa L chain}
evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay
nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
s

Timeline for d6fabh1:

• d6fabh1 first appeared (with stable ids) in SCOP 1.55
  
• d6fabh1 appears in SCOP 1.59
  
• d6fabh1 appears in the current release, SCOPe 2.08