Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab 36-71 (mouse), kappa L chain [48779] (1 PDB entry) |
Domain d6fabh1: 6fab H:1-121 [19909] Other proteins in same PDB: d6fabh2, d6fabl2 |
PDB Entry: 6fab (more details), 1.9 Å
SCOP Domain Sequences for d6fabh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fabh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 36-71 (mouse), kappa L chain} evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs s
Timeline for d6fabh1: