Lineage for d6fabh1 (6fab H:1-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7406Species Fab 36-71 (mouse), kappa L chain [48779] (1 PDB entry)
  8. 7407Domain d6fabh1: 6fab H:1-121 [19909]
    Other proteins in same PDB: d6fabh2, d6fabl2

Details for d6fabh1

PDB Entry: 6fab (more details), 1.9 Å

PDB Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten

SCOP Domain Sequences for d6fabh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fabh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 36-71 (mouse), kappa L chain}
evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay
nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
s

SCOP Domain Coordinates for d6fabh1:

Click to download the PDB-style file with coordinates for d6fabh1.
(The format of our PDB-style files is described here.)

Timeline for d6fabh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fabh2