Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [187038] (10 PDB entries) |
Domain d3azme_: 3azm E: [198998] Other proteins in same PDB: d3azma_, d3azmb_, d3azmc_, d3azmd_, d3azmf_, d3azmg_, d3azmh_ automated match to d3afae_ protein/DNA complex; complexed with cl, mn; mutant |
PDB Entry: 3azm (more details), 2.89 Å
SCOPe Domain Sequences for d3azme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3azme_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d3azme_: