Lineage for d1ggch1 (1ggc H:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022421Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 2022425Domain d1ggch1: 1ggc H:1-112 [19881]
    Other proteins in same PDB: d1ggch2, d1ggcl1, d1ggcl2
    part of Fab 50.1

Details for d1ggch1

PDB Entry: 1ggc (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody
PDB Compounds: (H:) igg2a-kappa 50.1 fab (heavy chain)

SCOPe Domain Sequences for d1ggch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggch1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qvqlqesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

SCOPe Domain Coordinates for d1ggch1:

Click to download the PDB-style file with coordinates for d1ggch1.
(The format of our PDB-style files is described here.)

Timeline for d1ggch1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggch2