Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d2yssb_: 2yss B: [198778] Other proteins in same PDB: d2yssa_, d2yssc_ automated match to d4aq1b_ mutant |
PDB Entry: 2yss (more details), 2.4 Å
SCOPe Domain Sequences for d2yssb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yssb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlqesgpglmkpsetlsltcsvsgdsirsdywswirkppgkgleyigyvsysgstyyn pslksrvtisvdtsknrfslklnsvtaadtavyycarwdgdywgqgilvtvss
Timeline for d2yssb_: