Lineage for d2yssb_ (2yss B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519653Domain d2yssb_: 2yss B: [198778]
    Other proteins in same PDB: d2yssa_, d2yssc_
    automated match to d4aq1b_
    mutant

Details for d2yssb_

PDB Entry: 2yss (more details), 2.4 Å

PDB Description: crystal structure of humanized hyhel-10 fv mutant(hq39kw47y)-hen lysozyme complex
PDB Compounds: (B:) anti-lysozyme antibody fv region

SCOPe Domain Sequences for d2yssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yssb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlqesgpglmkpsetlsltcsvsgdsirsdywswirkppgkgleyigyvsysgstyyn
pslksrvtisvdtsknrfslklnsvtaadtavyycarwdgdywgqgilvtvss

SCOPe Domain Coordinates for d2yssb_:

Click to download the PDB-style file with coordinates for d2yssb_.
(The format of our PDB-style files is described here.)

Timeline for d2yssb_: