Lineage for d1mcpl1 (1mcp L:1-114)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363702Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)
  8. 363747Domain d1mcpl1: 1mcp L:1-114 [19858]
    Other proteins in same PDB: d1mcph1, d1mcph2, d1mcpl2
    part of Fab MCPC603
    complexed with so4

Details for d1mcpl1

PDB Entry: 1mcp (more details), 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms

SCOP Domain Sequences for d1mcpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcpl1 b.1.1.1 (L:1-114) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikr

SCOP Domain Coordinates for d1mcpl1:

Click to download the PDB-style file with coordinates for d1mcpl1.
(The format of our PDB-style files is described here.)

Timeline for d1mcpl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcpl2