SCOPe 2.08: Domain d2v4oa1: 2v4o A:1-253

Lineage for d2v4oa1 (2v4o A:1-253)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)

8. Domain d2v4oa1: 2v4o A:1-253 [198381]
   Other proteins in same PDB: d2v4oa2, d2v4ob2, d2v4oc2, d2v4od2
   automated match to d2v4od_
   complexed with gol, mg, po4

Details for d2v4oa1

PDB Entry: 2v4o, 2.71 Å

PDB Description: crystal structure of salmonella typhimurium sure at 2.75 angstrom resolution in monoclinic form

PDB Compounds: (A:) multifunctional protein sur e

SCOPe Domain Sequences for d2v4oa1:

Sequence; same for both SEQRES and ATOM records:

>d2v4oa1 c.106.1.0 (A:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdvv
sdwldsvgvgtqw

Timeline for d2v4oa1:

• d2v4oa1 first appeared in SCOPe 2.03, called d2v4oa_
  
• d2v4oa1 appears in SCOPe 2.07