Lineage for d2rblb_ (2rbl B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2036143Protein automated matches [190888] (1 species)
    not a true protein
  7. 2036144Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)
  8. 2036176Domain d2rblb_: 2rbl B: [198334]
    automated match to d2rblm_

Details for d2rblb_

PDB Entry: 2rbl (more details), 2.1 Å

PDB Description: high resolution design of a protein loop
PDB Compounds: (B:) Tenascin

SCOPe Domain Sequences for d2rblb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rblb_ b.1.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldapsqievkdvtdttalitwsmqlsqlegieltygikdvpgdrttidltedenqysign
lkpdteyevslisrrgdmssnpaketftt

SCOPe Domain Coordinates for d2rblb_:

Click to download the PDB-style file with coordinates for d2rblb_.
(The format of our PDB-style files is described here.)

Timeline for d2rblb_: