SCOPe 2.05: Domain d2qlea_: 2qle A:

Lineage for d2qlea_ (2qle A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [188536] (1 PDB entry)

8. Domain d2qlea_: 2qle A: [198307]
   automated match to d2qled_
   complexed with imd; mutant

Details for d2qlea_

PDB Entry: 2qle, 1.59 Å

PDB Description: gfp/s205v mutant

PDB Compounds: (A:) Green fluorescence protein

SCOPe Domain Sequences for d2qlea_:

Sequence; same for both SEQRES and ATOM records:

>d2qlea_ d.22.1.1 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagithg

Timeline for d2qlea_:

• d2qlea_ first appeared in SCOPe 2.03
  
• d2qlea_ appears in SCOPe 2.04
  
• d2qlea_ appears in SCOPe 2.06
  
• d2qlea_ appears in the current release, SCOPe 2.08, called d2qlea1