SCOPe 2.05: Domain d2q2ha_: 2q2h A:

Lineage for d2q2ha_ (2q2h A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188408] (2 PDB entries)

8. Domain d2q2ha_: 2q2h A: [198268]
   automated match to d2q2hb_
   complexed with act, cit

Details for d2q2ha_

PDB Entry: 2q2h, 1.65 Å

PDB Description: Crystal structure of the protein secretion chaperone CsaA from Agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the N-terminus.

PDB Compounds: (A:) Secretion chaperone, phage-display derived peptide

SCOPe Domain Sequences for d2q2ha_:

Sequence; same for both SEQRES and ATOM records:

>d2q2ha_ b.40.4.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
qptaansgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitv
hytpeslvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc

Timeline for d2q2ha_:

• d2q2ha_ first appeared in SCOPe 2.03
  
• d2q2ha_ appears in SCOPe 2.04
  
• d2q2ha_ appears in SCOPe 2.06
  
• d2q2ha_ appears in the current release, SCOPe 2.08