Lineage for d2o5ib1 (2o5i B:1-49,B:173-229)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200656Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2200657Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 2200658Protein RNA polymerase alpha [55259] (3 species)
  7. 2200673Species Thermus thermophilus [TaxId:274] [75478] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2200699Domain d2o5ib1: 2o5i B:1-49,B:173-229 [198193]
    Other proteins in same PDB: d2o5ia2, d2o5ib2, d2o5ic_, d2o5id_, d2o5ie_, d2o5ik2, d2o5il2, d2o5im_, d2o5in_, d2o5io_
    automated match to d1smya1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2o5ib1

PDB Entry: 2o5i (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase elongation complex
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2o5ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5ib1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2o5ib1:

Click to download the PDB-style file with coordinates for d2o5ib1.
(The format of our PDB-style files is described here.)

Timeline for d2o5ib1: