Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d2o5ia1: 2o5i A:1-49,A:173-229 [198191] Other proteins in same PDB: d2o5ia2, d2o5ib2, d2o5ic_, d2o5id_, d2o5ie_, d2o5ik2, d2o5il2, d2o5im_, d2o5in_, d2o5io_ automated match to d1smya1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2o5i (more details), 2.5 Å
SCOPe Domain Sequences for d2o5ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5ia1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d2o5ia1: