Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein automated matches [226944] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries) |
Domain d2ntsa2: 2nts A:87-216 [198184] Other proteins in same PDB: d2ntsa1, d2ntsa3, d2ntsp1, d2ntsp2 automated match to d2g9hd2 |
PDB Entry: 2nts (more details), 2.4 Å
SCOPe Domain Sequences for d2ntsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntsa2 d.15.6.1 (A:87-216) automated matches {Staphylococcus aureus [TaxId: 93062]} eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek fhldvdisyk
Timeline for d2ntsa2: