SCOPe 2.06: Domain d2ntsa2: 2nts A:87-216

Lineage for d2ntsa2 (2nts A:87-216)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein automated matches [226944] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries)

8. Domain d2ntsa2: 2nts A:87-216 [198184]
   Other proteins in same PDB: d2ntsa1, d2ntsa3, d2ntsp1, d2ntsp2
   automated match to d2g9hd2

Details for d2ntsa2

PDB Entry: 2nts, 2.4 Å

PDB Description: Crystal Structure of SEK-hVb5.1

PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d2ntsa2:

Sequence; same for both SEQRES and ATOM records:

>d2ntsa2 d.15.6.1 (A:87-216) automated matches {Staphylococcus aureus [TaxId: 93062]}
eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk
kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek
fhldvdisyk

Timeline for d2ntsa2:

• d2ntsa2 first appeared in SCOPe 2.03
  
• d2ntsa2 appears in SCOPe 2.05
  
• d2ntsa2 appears in SCOPe 2.07
  
• d2ntsa2 appears in the current release, SCOPe 2.08