SCOP 1.65: Domain d2igfl1: 2igf L:1-107

Lineage for d2igfl1 (2igf L:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d2igfl1: 2igf L:1-107 [19816]
   Other proteins in same PDB: d2igfh1, d2igfh2, d2igfl2
   part of Fab B13I2
   complexed with nag

Details for d2igfl1

PDB Entry: 2igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d2igfl1:

Sequence; same for both SEQRES and ATOM records:

>d2igfl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqasiscrsnqtillsdgdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d2igfl1:

• d2igfl1 first appeared (with stable ids) in SCOP 1.55
  
• d2igfl1 appears in SCOP 1.63
  
• d2igfl1 appears in SCOP 1.67
  
• d2igfl1 appears in the current release, SCOPe 2.08