Lineage for d2flbl1 (2flb L:47-86)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031218Domain d2flbl1: 2flb L:47-86 [197928]
    Other proteins in same PDB: d2flbh_, d2flbt1, d2flbt2
    automated match to d1danl1
    complexed with 6nh

Details for d2flbl1

PDB Entry: 2flb (more details), 1.95 Å

PDB Description: discovery of a novel hydroxy pyrazole based factor ixa inhibitor
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2flbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flbl1 g.3.11.1 (L:47-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
gdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2flbl1:

Click to download the PDB-style file with coordinates for d2flbl1.
(The format of our PDB-style files is described here.)

Timeline for d2flbl1:

3031218
d2flbl1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2flbl2