SCOPe 2.04: Domain d2bkua_: 2bku A:

Lineage for d2bkua_ (2bku A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Dog (Canis familiaris) [TaxId:9615] [224975] (1 PDB entry)

8. Domain d2bkua_: 2bku A: [197791]
   Other proteins in same PDB: d2bkub1, d2bkud_
   automated match to d3ea5a_
   complexed with gtp, mg

Details for d2bkua_

PDB Entry: 2bku, 2.7 Å

PDB Description: kap95p:rangtp complex

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d2bkua_:

Sequence; same for both SEQRES and ATOM records:

>d2bkua_ c.37.1.8 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

Timeline for d2bkua_:

• d2bkua_ first appeared in SCOPe 2.03
  
• d2bkua_ appears in SCOPe 2.05
  
• d2bkua_ appears in the current release, SCOPe 2.08